missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticorps
  4. Anticorps primaires
  5. Tous les anticorps primaires
  6. UbcH5b/UBE2D2 Antibody, Novus Biologicals™

UbcH5b/UBE2D2 Antibody, Novus Biologicals™

Code produit 18282761 Tous les produits Bio Techne Produits
Change view
Click to view available options
Quantité:
100 μL
Conditionnement:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
18282761 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 18282761 Fournisseur Novus Biologicals Code fournisseur NBP155275

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Rabbit Polyclonal Antibody

UbcH5b/UBE2D2 Polyclonal specifically detects UbcH5b/UBE2D2 in Human samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Spécification

Antigène UbcH5b/UBE2D2
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugué Unconjugated
Dilution Western Blot 1.0 ug/ml
Formule PBS, 2% Sucrose with 0.09% Sodium Azide
Numéro d’ordre du gène P62837
Alias de gène E2(17)KB2, EC 6.3.2.19, PUBC1, UBC4/5, UBC4ubiquitin-conjugating enzyme E2D 2 (homologous to yeast UBC4/5), UBC5B, UBCH4, UbcH5B, Ubiquitin carrier protein D2, ubiquitin-conjugating enzyme E2 D2, Ubiquitin-conjugating enzyme E2(17)KB 2, Ubiquitin-conjugating enzyme E2-17 kDa 2, ubiquitin-conjugating enzyme E2D 2 (UBC4/5 homolog, yeast), Ubiquitin-protein ligase D2
Symboles de gène(s) UBE2D2
Espèces hôtes Rabbit
Immunogène Synthetic peptides corresponding to UBE2D2(ubiquitin-conjugating enzyme E2D 2 (UBC4/5 homolog, yeast)) The peptide sequence was selected from the N terminal of UBE2D2. Peptide sequence ALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFF.
Poids moléculaire de l’antigène 17 kDa
Méthode de purification Affinity purified
Quantité 100 μL
État réglementaire RUO
Disciplines de recherche Cancer, Hypoxia
Primaire ou secondaire Primary
Identification génétique (Entrez) 7322
Spécificité du test Goat: 79%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Espèces cibles Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Zebrafish
Contenu et stockage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.