missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
UBL3 Polyclonal antibody specifically detects UBL3 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)
Specifications
Specifications
| Antigène | UBL3 |
| Applications | ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugué | Alexa Fluor 647 |
| Formule | 50mM Sodium Borate |
| Alias de gène | DKFZP434K151, FLJ32018, HCG-1, hsMUB, Membrane-anchored ubiquitin-fold protein, MUB, PNSC1, Protein HCG-1, ubiquitin-like 3, ubiquitin-like protein 3 |
| Espèces hôtes | Rabbit |
| Immunogène | Recombinant fusion protein containing a sequence corresponding to amino acids 1-117 of human UBL3 (NP_009037.1).,, Sequence:, MSSNVPADMINLRLILVSGKTKEFLFSPNDSASDIAKHVYDNWPMDWEEEQVSSPNILRLIYQGRFLHGNVTLGALKLPFGKTTVMHLVARETLPEPNSQGQRNREKTGESNCCVIL |
| Méthode de purification | Affinity purified |
| Quantité | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?