missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
UNC50 Polyclonal antibody specifically detects UNC50 in Human, Mouse, Rat samples. It is validated for Western Blot
Spécification
Spécification
| Antigène | UNC50 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugué | Unconjugated |
| Dilution | Western Blot 1:500-1:2000 |
| Formule | PBS (pH 7.3), 50% glycerol |
| Alias de gène | geal-6 membrane-associated high-copy suppressor 1, GMH1, hGMH1, PDLs22, Periodontal ligament-specific protein 22, Protein GMH1 homolog, protein unc-50 homolog, unc-50 homolog (C. elegans), unc-50 related, UNCLDKFZp564G0222, Uncoordinated-like protein, URP |
| Espèces hôtes | Rabbit |
| Immunogène | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human UNC50 (NP_054763.2). MLPSTSVNSLVQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFG |
| Méthode de purification | Affinity purified |
| Afficher plus |
Nom du produit
En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.
Vous avez repéré une opportunité d'amélioration ?