missing translation for 'onlineSavingsMsg'
Learn More

USH1C Antibody [Alexa Fluor« 647], Novus Biologicals Biologicals™

Code produit 30498793 Tous les produits Bio Techne Produits
Modifier l'affichage
Click to view available options
Quantité:
0.1 mL
Conditionnement:
0.10mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
30498793 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 30498793 Fournisseur Novus Biologicals Code fournisseur NBP338088AF647

Please to purchase this item. Need a web account? Register with us today!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Rabbit Polyclonal Antibody

USH1C Polyclonal antibody specifically detects USH1C in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Spécification

Antigène USH1C
Applications ELISA, Western Blot
Classification Polyclonal
Conjugué Alexa Fluor 647
Formule 50mM Sodium Borate
Alias de gène AIE75, AIE-75, Antigen NY-CO-38/NY-CO-37, Autoimmune enteropathy-related antigen AIE-75, deafness, autosomal recessive 18, DFNB18, harmonin, NY-CO-37, NY-CO-38, PDZ-45, PDZ73, PDZ-73, PDZ-73/NY-CO-38, Protein PDZ-73, Renal carcinoma antigen NY-REN-3, ush1cpst, Usher syndrome 1C (autosomal recessive, severe), Usher syndrome type-1C protein
Espèces hôtes Rabbit
Immunogène Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of zebrafish USH1C (NP_001035018.1).,, Sequence:, MERKVAREFRHKVELLIDNEAEKDYLYDVLRMYHQSMDLPVLVGDLKLVINEPKRLPLFDAIRPLIPLKHQVQYDQLTPKRSRKLKEVRLDRTHPEGLGL
Méthode de purification Affinity purified
Quantité 0.1 mL
État réglementaire RUO
Primaire ou secondaire Primary
Identification génétique (Entrez) 10083
Espèces cibles Human, Mouse, Rat
Contenu et stockage Store at 4°C in the dark.
Type de produit Antibody
Forme Purified
Isotype IgG
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.