missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticorps
  4. Anticorps primaires
  5. Tous les anticorps primaires
  6. 30493306

USP18 Antibody [DyLight 550], Novus Biologicals Biologicals™

Code produit 30493306 Tous les produits Bio Techne Produits
Change view
Click to view available options
Quantité:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité
30493306 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 30493306 Fournisseur Novus Biologicals Code fournisseur NBP335697R

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Rabbit Polyclonal Antibody

USP18 Polyclonal antibody specifically detects USP18 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Spécification

Antigène USP18
Applications ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence
Classification Polyclonal
Conjugué DyLight 550
Formule 50mM Sodium Borate
Alias de gène EC 3.1.2.15, EC 3.4.19.-, hUBP43, ISG15-specific-processing protease, ISG43UBP43, ubiquitin specific peptidase 18, ubiquitin specific protease 18, ubl carboxyl-terminal hydrolase 18, ubl thioesterase 18,43 kDa ISG15-specific protease, Ubl thiolesterase 18
Espèces hôtes Rabbit
Immunogène A synthetic peptide corresponding to a sequence within amino acids 1-100 of human USP18 (NP_059110.2).,, Sequence:, DVDSKPLKTLEDALHCFFQPRELSSKSKCFCENCGKKTRGKQVLKLTHLPQTLTIHLMRFSIRNSQTRKICHSLYFPQSLDFSQILPMKRESCDAEEQSGG
Méthode de purification Affinity purified
Quantité 0.1 mL
État réglementaire RUO
Disciplines de recherche Cell Biology, Neuroscience, Ubiquitin Proteasome Pathway
Primaire ou secondaire Primary
Identification génétique (Entrez) 11274
Espèces cibles Human, Mouse, Rat
Contenu et stockage Store at 4°C in the dark.
Type de produit Antibody
Forme Purified
Isotype IgG
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.