missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticorps
  4. Anticorps primaires
  5. Tous les anticorps primaires
  6. VPS4A Antibody, Novus Biologicals™

VPS4A Antibody, Novus Biologicals™

Code produit 18261731 Tous les produits Bio Techne Produits
Change view
Click to view available options
Quantité:
100 μL
Conditionnement:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
18261731 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 18261731 Fournisseur Novus Biologicals Code fournisseur NBP155140

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Rabbit Polyclonal Antibody

VPS4A Polyclonal specifically detects VPS4A in Human samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Spécification

Antigène VPS4A
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugué Unconjugated
Dilution Western Blot 1.0 ug/ml
Formule PBS, 2% Sucrose with 0.09% Sodium Azide
Numéro d’ordre du gène Q9UN37
Alias de gène FLJ22197, hVPS4, Protein SKD2, SKD1, SKD1A, SKD2, vacuolar protein sorting 4 homolog A (S. cerevisiae), vacuolar protein sorting 4A (yeast homolog), vacuolar protein sorting factor 4A, vacuolar protein sorting-associated protein 4A, vacuolar sorting protein 4, VPS4-1SKD1-homolog, VPS4vacuolar protein sorting 4A (yeast)
Symboles de gène(s) VPS4A
Espèces hôtes Rabbit
Immunogène Synthetic peptides corresponding to VPS4A(vacuolar protein sorting 4 homolog A (S. cerevisiae)) The peptide sequence was selected from the N terminal of VPS4A. Peptide sequence LRSKEKHGKKPVKENQSEGKGSDSDSEGDNPEKKKLQEQLMGAVVMEKPN.
Poids moléculaire de l’antigène 49 kDa
Méthode de purification Affinity purified
Quantité 100 μL
État réglementaire RUO
Disciplines de recherche Protein Phosphatase
Primaire ou secondaire Primary
Identification génétique (Entrez) 27183
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Espèces cibles Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
Contenu et stockage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.