missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticorps
  4. Anticorps primaires
  5. Tous les anticorps primaires
  6. VPS54 Antibody, Novus Biologicals™

VPS54 Antibody, Novus Biologicals™

Code produit 18289604 Tous les produits Bio Techne Produits
Change view
Click to view available options
Quantité:
100 μL
Conditionnement:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
18289604 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 18289604 Fournisseur Novus Biologicals Code fournisseur NBP157579

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Rabbit Polyclonal Antibody

VPS54 Polyclonal specifically detects VPS54 in Human samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Spécification

Antigène VPS54
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugué Unconjugated
Dilution Western Blot 1.0 ug/ml
Formule PBS, 2% Sucrose with 0.09% Sodium Azide
Numéro d’ordre du gène Q9P1Q0
Alias de gène HCC8SLP-8p, Hepatocellular carcinoma protein 8, hVps54L, Tumor antigen HOM-HCC-8, Tumor antigen SLP-8p, vacuolar protein sorting 54 (yeast), vacuolar protein sorting 54 homolog (S. cerevisiae), vacuolar protein sorting-associated protein 54, VPS54L
Symboles de gène(s) VPS54
Espèces hôtes Rabbit
Immunogène Synthetic peptides corresponding to VPS54(vacuolar protein sorting 54 homolog (S. cerevisiae)) The peptide sequence was selected from the N terminal of VPS54. Peptide sequence FYLPQISKEHFTVYQQEISQREKIHERCKNICPPKDTFERTLLHTHDKSR.
Poids moléculaire de l’antigène 107 kDa
Méthode de purification Affinity purified
Quantité 100 μL
État réglementaire RUO
Primaire ou secondaire Primary
Identification génétique (Entrez) 51542
Spécificité du test Expected identity based on immunogen sequence: Chicken: 78%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Espèces cibles Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
Contenu et stockage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.