missing translation for 'onlineSavingsMsg'
Learn More

Xanthine Oxidase Antibody [DyLight 488], Novus Biologicals Biologicals™

Code produit 30498774 Tous les produits Bio Techne Produits
Modifier l'affichage
Click to view available options
Quantité:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité
30498774 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 30498774 Fournisseur Novus Biologicals Code fournisseur NBP335302G

Please to purchase this item. Need a web account? Register with us today!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Rabbit Polyclonal Antibody

Xanthine Oxidase Polyclonal antibody specifically detects Xanthine Oxidase in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Spécification

Antigène Xanthine Oxidase
Applications ELISA, Western Blot
Classification Polyclonal
Conjugué DyLight 488
Formule 50mM Sodium Borate
Alias de gène EC 1.17.1.4, EC 1.7.2.2, xanthene dehydrogenase, xanthine dehydrogenase, xanthine dehydrogenase/oxidase, xanthine oxidase, xanthine oxidoreductase, XDHA, XO, XOR
Espèces hôtes Rabbit
Immunogène A synthetic peptide corresponding to a sequence within amino acids 985-1084 of human Xanthine Oxidase (XDH) (NP_000370.2).,, Sequence:, CIIPTKFGISFTVPFLNQAGALLHVYTDGSVLLTHGGTEMGQGLHTKMVQVASRALKIPTSKIYISETSTNTVPNTSPTAASVSADLNGQAVYAACQTILK
Méthode de purification Affinity purified
Quantité 0.1 mL
État réglementaire RUO
Disciplines de recherche Signal Transduction
Primaire ou secondaire Primary
Identification génétique (Entrez) 7498
Espèces cibles Human, Mouse, Rat
Contenu et stockage Store at 4°C in the dark.
Type de produit Antibody
Forme Purified
Isotype IgG
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.