missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticorps
  4. Anticorps primaires
  5. Tous les anticorps primaires
  6. YY2 Antibody - Azide and BSA Free, Novus Biologicals™

YY2 Antibody - Azide and BSA Free, Novus Biologicals™

Codice prodotto. 18603160 Sfoglia Tutto Bio Techne Prodotti
Cambia vista
Click to view available options
Quantité:
0.02 mL
0.1 mL
Dimensione della confezione:
0.02mL
0.10mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Codice prodotto. Quantité Dimensione della confezione
18603160 0.02 mL 0.02mL
18660751 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso
Codice prodotto. 18603160 Fornitore Novus Biologicals N. del fornitore NBP2939050.02ml
 Article restreint
Expédition estimée: 02-12-2026
Aggiungi al carrello
Aggiungi al carrello

missing translation for 'validMainframeMsg'

Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Descrizione

Rabbit Polyclonal Antibody

YY2 Polyclonal specifically detects YY2 in Human, Mouse, Rat samples. It is validated for ELISA, Immunocytochemistry/Immunofluorescence, Western Blot.
TRUSTED_SUSTAINABILITY

Spezifikation

Antigène YY2
Applications ELISA, Immunocytochemistry/Immunofluorescence, Western Blot
Classification Polyclonal
Conjugué Unconjugated
Dilution Western Blot 1:500-1:2000, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
Formule PBS (pH 7.3), 50% glycerol
Alias de gène transcription factor YY2, YY2 transcription factor, ZNF631
Espèces hôtes Rabbit
Immunogène A synthetic peptide corresponding to a sequence within amino acids 200-300 of human YY2 (NP_996806.2). GEGQAENPPDYSEYLKGKKLPPGGLPGIDLSDPKQLAEFTKVKPKRSKGEPPKTVPCSYSGCEKMFRDYAAMRKHLHIHGPRVHVCAECGKAFLESSKLRR
Méthode de purification Affinity purified
Quantité 0.02 mL
État réglementaire RUO
Disciplines de recherche Endocrinology
Primaire ou secondaire Primary
Identification génétique (Entrez) 404281
Espèces cibles Human, Mouse, Rat
Contenu et stockage Store at -20°C. Avoid freeze-thaw cycles.
Type de produit Antibody
Forme Purified
Isotype IgG
Gamme de produits Novus
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.