missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZDHHC7 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Marque: Novus Biologicals NBP2-94487-0.02ml
Les retours ne sont pas autorisés pour ce produit.
Afficher la politique du retour.
Description
ZDHHC7 Polyclonal antibody specifically detects ZDHHC7 in Human, Mouse samples. It is validated for Western Blot
Spécification
| ZDHHC7 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| EC 2.3.1, EC 2.3.1.-, FLJ10792, FLJ20279, palmitoyltransferase ZDHHC7, Sertoli cell gene with zinc finger domain- and #946, SERZ1, SERZ-B, Zinc finger DHHC domain-containing protein 7, Zinc finger protein 370, zinc finger, DHHC domain containing 7, zinc finger, DHHC-type containing 7, ZNF370DHHC-7 | |
| A synthetic peptide corresponding to a sequence within amino acids 210 to the C-terminus of human ZDHHC7 (NP_060210.2). DFSPPITVILLIFLCLEGLLFFTFTAVMFGTQIHSICNDETEIERLKSEKPTWERRLRWEGMKSVFGGPPSLLWMNPFVGFRFRRLPTRPRKGGPEFSV | |
| 0.02 mL | |
| Neuroscience, Signal Transduction | |
| 55625 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu