missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticorps
  4. Anticorps primaires
  5. Tous les anticorps primaires
  6. ZMPSTE24 Antibody, Novus Biologicals™

ZMPSTE24 Antibody, Novus Biologicals™

Code produit 18455900 Tous les produits Bio Techne Produits
Change view
Click to view available options
Quantité:
0.1 mL
25 μL
Conditionnement:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
18455900 25 μL 25µL
18496550 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 18455900 Fournisseur Novus Biologicals Code fournisseur NBP18475525ul

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Rabbit Polyclonal Antibody

ZMPSTE24 Polyclonal antibody specifically detects ZMPSTE24 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Spécification

Antigène ZMPSTE24
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugué Unconjugated
Dilution Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
Formule PBS (pH 7.2) and 40% Glycerol
Alias de gène zona pellucida binding protein 2, zona pellucida-binding protein 2, ZPBP-like protein, ZPBPLMGC41930
Espèces hôtes Rabbit
Immunogène This antibody was developed against Recombinant Protein corresponding to amino acids: KTTTHVPPELGQIMDSETFEKSRLYQLDKSTFS
Méthode de purification Immunogen affinity purified
Quantité 25 μL
État réglementaire RUO
Disciplines de recherche Angiogenesis, Cancer, Cell Biology, Cellular Markers, Extracellular Matrix, Signal Transduction, Ubiquitin Proteasome Pathway
Primaire ou secondaire Primary
Identification génétique (Entrez) 10269
Espèces cibles Human
Contenu et stockage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Forme Purified
Isotype IgG
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.