missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticorps
  4. Anticorps primaires
  5. Tous les anticorps primaires
  6. ZNF205 Antibody, Novus Biologicals™

ZNF205 Antibody, Novus Biologicals™

Code produit 18270576 Shop All Bio Techne Products
Change view
Click to view available options
Quantité:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantité unitSize
18270576 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18270576 Supplier Novus Biologicals Supplier No. NBP180302

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

ZNF205 Polyclonal specifically detects ZNF205 in Human samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Specifications

Antigène ZNF205
Applications Western Blot
Classification Polyclonal
Concentration 1 mg/ml
Conjugué Unconjugated
Dilution Western Blot 1.0 ug/ml
Formule PBS, 2% Sucrose with 0.09% Sodium Azide
Numéro d’ordre du gène NP_001026856
Alias de gène zinc finger protein 205, Zinc finger protein 210, ZNF210Zfp13
Symboles de gène(s) ZNF205
Espèces hôtes Rabbit
Immunogène Synthetic peptide directed towards the N terminal of human ZNF205. Peptide sequence PSKLGEAVPSGDTQESLHIKMEPEEPHSEGASQEDGAQGAWGWAPLSHGS.
Méthode de purification Protein A purified
Quantité 100 μL
État réglementaire RUO
Primaire ou secondaire Primary
Identification génétique (Entrez) 7755
Spécificité du test Expected identity based on immunogen sequence: Human: 100%; Bovine: 84%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Espèces cibles Human, Mouse, Rat, Bovine, Canine, Guinea Pig
Contenu et stockage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Forme Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.