missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticorps
  4. Anticorps primaires
  5. Tous les anticorps primaires
  6. ZNF546 Antibody, Novus Biologicals™

ZNF546 Antibody, Novus Biologicals™

Code produit 18288035 Tous les produits Bio Techne Produits
Change view
Click to view available options
Quantité:
100 μL
Conditionnement:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
18288035 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 18288035 Fournisseur Novus Biologicals Code fournisseur NBP180191

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Rabbit Polyclonal Antibody

ZNF546 Polyclonal specifically detects ZNF546 in Human samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Spécification

Antigène ZNF546
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugué Unconjugated
Dilution Western Blot 1.0 ug/ml
Formule PBS, 2% Sucrose with 0.09% Sodium Azide
Numéro d’ordre du gène NP_848639
Alias de gène MGC43537, zinc finger protein 49, zinc finger protein 546, ZNF49
Symboles de gène(s) ZNF546
Espèces hôtes Rabbit
Immunogène Synthetic peptide directed towards the N terminal of human ZNF546. Peptide sequence LSEKNVCKIYLSQLQTGEKSKNTIHEDTIFRNGLQCKHEFERQERHQMGC.
Poids moléculaire de l’antigène 98 kDa
Méthode de purification Affinity purified
Quantité 100 μL
État réglementaire RUO
Primaire ou secondaire Primary
Identification génétique (Entrez) 339327
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Espèces cibles Human
Contenu et stockage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.