missing translation for 'onlineSavingsMsg'
Learn More

ZNF699 Antibody, Novus Biologicals™

Code produit 18353631 Tous les produits Bio Techne Produits
Modifier l'affichage
Click to view available options
Quantité:
100 μL
Conditionnement:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité unitSize
18353631 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 18353631 Fournisseur Novus Biologicals Code fournisseur NBP191376

Please to purchase this item. Need a web account? Register with us today!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Rabbit Polyclonal Antibody

ZNF699 Polyclonal specifically detects ZNF699 in Human samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Spécification

Antigène ZNF699
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugué Unconjugated
Dilution Western Blot 1.0 ug/ml
Formule PBS, 2% Sucrose with 0.09% Sodium Azide
Numéro d’ordre du gène NP_940937
Alias de gène FLJ38144, hang, hangover homolog, hangover, Drosophila, homolog of, MGC129880, MGC129881, zinc finger protein 699
Symboles de gène(s) ZNF699
Espèces hôtes Rabbit
Immunogène Synthetic peptide directed towards the N terminal of human ZNF699. Peptide sequence EEDLQTVKRELIQGIFMGEHREGFETQLKTNESVASQDICGEKISNEQKI.
Poids moléculaire de l’antigène 74 kDa
Méthode de purification Affinity purified
Quantité 100 μL
État réglementaire RUO
Primaire ou secondaire Primary
Identification génétique (Entrez) 374879
Spécificité du test Expected identity based on immunogen sequence: Equine: 100% Rat 86% Canine 77%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Espèces cibles Human, Rat, Canine, Equine
Contenu et stockage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.