missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Acetyl-CoA Carboxylase alpha/ACACA Rabbit anti-Human, Mouse, Rat, Clone: 5J4W7, Novus Biologicals™
Rabbit Monoclonal Antibody
Marque: Novus Biologicals NBP3-15744-100UL
Les retours ne sont pas autorisés pour ce produit.
Afficher la politique du retour.
Description
Acetyl-CoA Carboxylase alpha/ACACA Monoclonal antibody specifically detects Acetyl-CoA Carboxylase alpha/ACACA in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin)
Spécification
| Acetyl-CoA Carboxylase alpha/ACACA | |
| Monoclonal | |
| Unconjugated | |
| PBS, 0.05% BSA, 50% glycerol, pH7.3 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
| Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin) | |
| 5J4W7 | |
| Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunoprecipitation 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| ACACacetyl-CoA carboxylase 1, ACC1ACC, ACCA, ACC-alpha, acetyl-CoA carboxylase alpha, acetyl-Coenzyme A carboxylase alpha, EC 6.4.1.2 | |
| A synthetic peptide corresponding to a sequence within amino acids 350-450 of human Acetyl-CoA Carboxylase alpha/ACACA (Q13085). RLAKQSRHLEVQILADQYGNAISLFGRDCSVQRRHQKIIEEAPATIATPAVFEHMEQCAVKLAKMVGYVSAGTVEYLYSQDGSFYFLELNPRLQVEHPCTE | |
| 100 μg | |
| Breast Cancer, Lipid and Metabolism, Neuroscience | |
| 31 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu