missing translation for 'onlineSavingsMsg'
Learn More
Learn More
-Immunohistochemistry-Paraffin-NBP3-15744-img0001.jpg-650.jpg)
-Immunohistochemistry-Paraffin-NBP3-15744-img0002.jpg-650.jpg)
-Immunoprecipitation-NBP3-15744-img0005.jpg-650.jpg)
-Western-Blot-NBP3-15744-img0003.jpg-650.jpg)
-Western-Blot-NBP3-15744-img0004.jpg-650.jpg)
Acetyl-CoA Carboxylase alpha/ACACA Rabbit anti-Human, Mouse, Rat, Clone: 5J4W7, Novus Biologicals™
Rabbit Monoclonal Antibody
201.00€ - 497.00€
Spécification
| Antigène | Acetyl-CoA Carboxylase alpha/ACACA |
|---|---|
| Clone | 5J4W7 |
| Dilution | Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunoprecipitation 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin) |
| Classification | Monoclonal |
| Code produit | Marque | Quantité | Prix | Quantité et disponibilité | |||||
|---|---|---|---|---|---|---|---|---|---|
| Code produit | Marque | Quantité | Prix | Quantité et disponibilité | |||||
|
18398144
|
Novus Biologicals
NBP3-15744-20UL |
20 μg |
201.00€
20µL |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | |||||
|
18304984
|
Novus Biologicals
NBP3-15744-100UL |
100 μg |
497.00€
100µL |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | |||||
Description
Acetyl-CoA Carboxylase alpha/ACACA Monoclonal antibody specifically detects Acetyl-CoA Carboxylase alpha/ACACA in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin)Spécification
| Acetyl-CoA Carboxylase alpha/ACACA | |
| Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunoprecipitation 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| ACACacetyl-CoA carboxylase 1, ACC1ACC, ACCA, ACC-alpha, acetyl-CoA carboxylase alpha, acetyl-Coenzyme A carboxylase alpha, EC 6.4.1.2 | |
| A synthetic peptide corresponding to a sequence within amino acids 350-450 of human Acetyl-CoA Carboxylase alpha/ACACA (Q13085). RLAKQSRHLEVQILADQYGNAISLFGRDCSVQRRHQKIIEEAPATIATPAVFEHMEQCAVKLAKMVGYVSAGTVEYLYSQDGSFYFLELNPRLQVEHPCTE | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| 5J4W7 | |
| Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Breast Cancer, Lipid and Metabolism, Neuroscience | |
| PBS, 0.05% BSA, 50% glycerol, pH7.3 | |
| 31 | |
| IgG | |
| Affinity purified |
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit