Cytochrome P450 2D6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marque: Novus Biologicals NBP1-91818-25ul

Code nomenclature Nacres: NA.46

Afficher plus de versions de ce produit

Code produit. 18493332

302.00€ / 25µL

Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Cytochrome P450 2D6 Polyclonal specifically detects Cytochrome P450 2D6 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Spécification

Antigène	Cytochrome P450 2D6
Classification	Polyclonal
Dilution	Western Blot 0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Alias de gène	CPD6P450DB1, CYP2D, CYP2D7AP, CYP2D7BP, CYP2D7P2, CYP2D8P2, CYP2DL1, CYPIID6, cytochrome P450 2D6, cytochrome P450, family 2, subfamily D, polypeptide 6, cytochrome P450, family 2, subfamily D, polypeptide 7 pseudogene 2, cytochrome P450, family 2, subfamily D, polypeptide 8 pseudogene 2, cytochrome P450, subfamily II (debrisoquine, sparteine, etc., -metabolising), cytochrome P450, subfamily IID (debrisoquine, sparteine, etc., cytochrome P450, subfamily IID (debrisoquine, sparteine, etc., -metabolising), cytochrome P450, subfamily IID (debrisoquine, sparteine, etc., -metabolizing), Cytochrome P450-DB1, Debrisoquine 4-hydroxylase, EC 1.14.14.1, flavoprotein-linked monooxygenase, -metabolizing)-like 1, MGC120389, MGC120390, microsomal monooxygenase, P450C2D, P450-DB1, polypeptide 6, polypeptide 7 pseudogene 2, polypeptide 8 pseudogene 2, xenobiotic monooxygenase
Espèces hôtes	Rabbit
Méthode de purification	Affinity Purified
État réglementaire	RUO
Identification génétique (Entrez)	1565
Espèces cibles	Human
Isotype	IgG

Applications	Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugué	Unconjugated
Formule	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Symboles de gène(s)	CYP2D6
Immunogène	This antibody was developed against Recombinant Protein corresponding to amino acids:EYDDPRFLRLLDLAQEGLKEESGFLREVLNAVPVLLHIPALAGKVLRFQKAFLTQLDELLTEHRMTWDPAQPPRDLTE
Quantité	25 μL
Primaire ou secondaire	Primary
Spécificité du test	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Contenu et stockage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Suggestions de produits

Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

Votre nom

Votre adresse e-mail *

Type de problème *

Description détaillée du problème/de la demande *

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Annuler Soumettre

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis

For Research Use Only

Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu

Cytochrome P450 2D6 Antibody, Novus Biologicals™

Description

Spécification

Suggestions de produits

Documents

Promotions