missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Cytochrome P450 2D6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
302.00€
Spécification
| Antigène | Cytochrome P450 2D6 |
|---|---|
| Dilution | Western Blot 0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugué | Unconjugated |
Description
Cytochrome P450 2D6 Polyclonal specifically detects Cytochrome P450 2D6 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Spécification
| Cytochrome P450 2D6 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 1565 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:EYDDPRFLRLLDLAQEGLKEESGFLREVLNAVPVLLHIPALAGKVLRFQKAFLTQLDELLTEHRMTWDPAQPPRDLTE | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| CPD6P450DB1, CYP2D, CYP2D7AP, CYP2D7BP, CYP2D7P2, CYP2D8P2, CYP2DL1, CYPIID6, cytochrome P450 2D6, cytochrome P450, family 2, subfamily D, polypeptide 6, cytochrome P450, family 2, subfamily D, polypeptide 7 pseudogene 2, cytochrome P450, family 2, subfamily D, polypeptide 8 pseudogene 2, cytochrome P450, subfamily II (debrisoquine, sparteine, etc., -metabolising), cytochrome P450, subfamily IID (debrisoquine, sparteine, etc., cytochrome P450, subfamily IID (debrisoquine, sparteine, etc., -metabolising), cytochrome P450, subfamily IID (debrisoquine, sparteine, etc., -metabolizing), Cytochrome P450-DB1, Debrisoquine 4-hydroxylase, EC 1.14.14.1, flavoprotein-linked monooxygenase, -metabolizing)-like 1, MGC120389, MGC120390, microsomal monooxygenase, P450C2D, P450-DB1, polypeptide 6, polypeptide 7 pseudogene 2, polypeptide 8 pseudogene 2, xenobiotic monooxygenase | |
| CYP2D6 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit