missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FSD2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Marque: Novus Biologicals NBP3-09505-100UL
Les retours ne sont pas autorisés pour ce produit.
Afficher la politique du retour.
Description
FSD2 Polyclonal specifically detects FSD2 in Human samples. It is validated for Western Blot.
Spécification
| FSD2 | |
| Polyclonal | |
| Western Blot 1.0 ug/ml | |
| FSD2 fibronectin type III and SPRY domain containing 2, RP11-127F21, SPRYD1 | |
| The immunogen is a synthetic peptide directed towards the C-terminal region of Human FSD2 (NP_001007123). Peptide sequence DYRVGVAFADVRKQEDLGANCLSWCMRHTFASSRHKYEFLHNRTTPDIRI | |
| 100 μg | |
| Primary | |
| Human | |
| Purified |
| Western Blot | |
| Unconjugated | |
| PBS buffer, 2% sucrose | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 123722 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu