missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FSD2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
461.00€
Spécification
| Antigène | FSD2 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugué | Unconjugated |
Description
FSD2 Polyclonal specifically detects FSD2 in Human samples. It is validated for Western Blot.Spécification
| FSD2 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| FSD2 fibronectin type III and SPRY domain containing 2, RP11-127F21, SPRYD1 | |
| The immunogen is a synthetic peptide directed towards the C-terminal region of Human FSD2 (NP_001007123). Peptide sequence DYRVGVAFADVRKQEDLGANCLSWCMRHTFASSRHKYEFLHNRTTPDIRI | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 123722 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit