missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Histone Deacetylase 2/HDAC2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
302.00€ - 456.00€
Spécification
| Antigène | Histone Deacetylase 2/HDAC2 |
|---|---|
| Dilution | Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50, Knockdown Validated |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugué | Unconjugated |
| Code produit | Marque | Quantité | Prix | Quantité et disponibilité | |||||
|---|---|---|---|---|---|---|---|---|---|
| Code produit | Marque | Quantité | Prix | Quantité et disponibilité | |||||
|
18414761
|
Novus Biologicals
NBP1-87109-25ul |
25 μL |
302.00€
25µL |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | |||||
|
18735923
|
Novus Biologicals
NBP1-87109 |
0.1 mL |
456.00€
0.10mL |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | |||||
Description
Histone Deacetylase 2/HDAC2 Polyclonal specifically detects Histone Deacetylase 2/HDAC2 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.Spécification
| Histone Deacetylase 2/HDAC2 | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human, Mouse, Rat | |
| Q92769 | |
| 3066 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:IACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSNP | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| 55 kDa |
| Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50, Knockdown Validated | |
| Polyclonal | |
| Rabbit | |
| Breast Cancer, Cancer, Chromatin Research, Epigenetics, Histone Deacetylases, Stem Cell Markers | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| EC 3.5.1.98, HD2, histone deacetylase 2, RPD3, transcriptional regulator homolog RPD3, YAF1, YY1-associated factor 1 | |
| HDAC2 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit