missing translation for 'onlineSavingsMsg'
Learn More
Abnova™ Human RGS14 Partial ORF (NP_006471, 468 a.a. - 566 a.a.) Recombinant Protein with GST-tag at N-terminal Code produit.: 16135472

Abnova™ Human RGS14 Partial ORF (NP_006471, 468 a.a. - 566 a.a.) Recombinant Protein with GST-tag at N-terminal

Code produit. 16135472
25 μg, 25µg
Code nomenclature Nacres: NA.28
Click to view available options
Quantité:
10 μg
25 μg
Conditionnement:
10µg
25µg
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 16135472

Marque: Abnova™ H00010636Q01.25ug

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Cet article est supprimé, vous trouverez le remplacement et les alternatives dans les onglets respectifs ci-dessous s'ils ont été identifiés
Voir les produits de remplacement

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Used for AP, Array, ELISA, WB-Re

This gene encodes a member of the regulator of G-protein signaling family. This protein contains one RGS domain, two Raf-like Ras-binding domains (RBDs), and one GoLoco domain. The protein attenuates the signaling activity of G-proteins by binding, through its GoLoco domain, to specific types of activated, GTP-bound G alpha subunits. Acting as a GTPase activating protein (GAP), the protein increases the rate of conversion of the GTP to GDP. This hydrolysis allows the G alpha subunits to bind G beta/gamma subunit heterodimers, forming inactive G-protein heterotrimers, thereby terminating the signal. Alternate transcriptional splice variants of this gene have been observed but have not been thoroughly characterized. [provided by RefSeq]

Sequence: QDKATHPPPASPSSLVKVPSSATGKRQTCDIEGLVELLNRVQSSGAHDQRGLLRKEDLVLPEFLQLPAQGPSSEETPPQTKSAAQPIGGSLNSTTDSAL

Spécification

Numéro d’adhésion NP_006471
À utiliser avec (application) Antibody Production, ELISA, Protein Array, Western Blot
Formule 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Identification génétique (Entrez) 10636
Poids moléculaire 36.63kDa
Nom RGS14 (Human) Recombinant Protein (Q01)
Test du contrôle qualité 12.5% SDS-PAGE Stained with Coomassie Blue.
Quantité 25 μg
Immunogène QDKATHPPPASPSSLVKVPSSATGKRQTCDIEGLVELLNRVQSSGAHDQRGLLRKEDLVLPEFLQLPAQGPSSEETPPQTKSAAQPIGGSLNSTTDSAL
Conditions de stockage Store at -80°C. Aliquot to avoid repeated freezing and thawing.
État réglementaire RUO
Nom usuel RGS14
Symbole de gène(s) RGS14
Espèces Wheat Germ (in vitro)
Recombinant Recombinant
Marqueur de protéine GST
Système d’expression wheat germ expression system
Forme Liquid
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit
Abnova™ Human RGS14 Partial ORF (NP_006471, 468 a.a. - 566 a.a.) Recombinant Protein with GST-tag at N-terminal >

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis