Integrin alpha 4/CD49d Rabbit anti-Human, Mouse, Rat, Clone: 8M8C2, Novus Biologicals™

Rabbit Monoclonal Antibody

Marque: Novus Biologicals NBP3-16322-100UL

Code nomenclature Nacres: NA.46

Afficher plus de versions de ce produit

Code produit. 18377842

520.00€ / 100µL

Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Integrin alpha 4/CD49d Monoclonal antibody specifically detects Integrin alpha 4/CD49d in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin)

Spécification

Antigène	Integrin alpha 4/CD49d
Classification	Monoclonal
Conjugué	Unconjugated
Formule	PBS, 0.05% BSA, 50% glycerol, pH7.3
Espèces hôtes	Rabbit
Méthode de purification	Affinity purified
État réglementaire	RUO
Primaire ou secondaire	Primary
Espèces cibles	Human, Mouse, Rat
Forme	Purified

Applications	Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin)
Clone	8M8C2
Dilution	Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunoprecipitation 1:50 - 1:200, Immunohistochemistry-Paraffin
Alias de gène	269C wild type, CD49 antigen-like family member D, CD49d, CD49d antigen, CD49Dantigen CD49D, alpha-4 subunit of VLA-4 receptor, IA4, integrin alpha 4, integrin alpha-4, integrin alpha-4 subunit, Integrin alpha-IV, integrin, alpha 4 (antigen CD49D, alpha 4 subunit of VLA-4 receptor), MGC90518, very late activation protein 4 receptor, alpha 4 subunit, VLA-4 subunit alpha
Immunogène	A synthetic peptide corresponding to a sequence within amino acids 933-1032 of human Integrin alpha 4/CD49d (P13612). ALKFEIRATGFPEPNPRVIELNKDENVAHVLLEGLHHQRPKRYFTIVIISSSLLLGLIVLLLISYVMWKAGFFKRQYKSILQEENRRDSWSYINSKSNDD
Quantité	100 μg
Disciplines de recherche	Cancer, Cell Biology, Cellular Markers, Cytokine Research, Growth and Development, Lysosome Markers, Mast Cell Markers, Membrane Trafficking and Chaperones, Microautophagy, Neuronal Cell Markers
Identification génétique (Entrez)	3676
Contenu et stockage	Store at -20°C. Avoid freeze-thaw cycles.
Isotype	IgG

Suggestions de produits

Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

Votre nom

Votre adresse e-mail *

Type de problème *

Description détaillée du problème/de la demande *

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Annuler Soumettre

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis

Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu

Integrin alpha 4/CD49d Rabbit anti-Human, Mouse, Rat, Clone: 8M8C2, Novus Biologicals™

Description

Spécification

Suggestions de produits

Documents

Promotions