missing translation for 'onlineSavingsMsg'
Learn More
Learn More
p53 AIP1 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Marque: Novus Biologicals NBP2-94841-0.02ml
Les retours ne sont pas autorisés pour ce produit.
Afficher la politique du retour.
Description
p53 AIP1 Polyclonal antibody specifically detects p53 AIP1 in Human, Mouse, Rat samples. It is validated for Western Blot
Spécification
| p53 AIP1 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| p53AIP1, p53-regulated apoptosis-inducing protein 1, tumor protein p53 regulated apoptosis inducing protein 1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-108 of human TP53AIP1 (NP_001238893.1). MGSSSEASFRSAQASCSGARRQGLGRGDQNLSVMPPNGRAQTHTPGWVSPCSENRDGLLPATAPGRLCSHRGADIPSFQTHQDPVTASGSSELHADCPQFRALDRAGN | |
| 0.02 mL | |
| Apoptosis, DNA Repair | |
| 63970 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu