missing translation for 'onlineSavingsMsg'
Learn More
Learn More
p53 AIP1 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
196.00€ - 468.00€
Spécification
| Antigène | p53 AIP1 |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugué | Unconjugated |
Description
p53 AIP1 Polyclonal antibody specifically detects p53 AIP1 in Human, Mouse, Rat samples. It is validated for Western BlotSpécification
| p53 AIP1 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Apoptosis, DNA Repair | |
| PBS (pH 7.3), 50% glycerol | |
| 63970 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| p53AIP1, p53-regulated apoptosis-inducing protein 1, tumor protein p53 regulated apoptosis inducing protein 1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-108 of human TP53AIP1 (NP_001238893.1). MGSSSEASFRSAQASCSGARRQGLGRGDQNLSVMPPNGRAQTHTPGWVSPCSENRDGLLPATAPGRLCSHRGADIPSFQTHQDPVTASGSSELHADCPQFRALDRAGN | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit