missing translation for 'onlineSavingsMsg'
Learn More
Learn More
POLE4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marque: Novus Biologicals NBP2-49672-25ul
Les retours ne sont pas autorisés pour ce produit.
Afficher la politique du retour.
Description
POLE4 Polyclonal antibody specifically detects POLE4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Spécification
| POLE4 | |
| Polyclonal | |
| Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| DNA polymerase epsilon p12 subunit, DNA polymerase epsilon subunit 4, DNA polymerase epsilon subunit p12, DNA polymerase II subunit 4, EC 2.7.7.7, p12, polymerase (DNA-directed), epsilon 4 (p12 subunit), YHHQ1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: GQEAIFILARAAELFVETIAKDAYCCAQQGKRKTLQRRDLDNAIEAVDEFAFLEGTLD | |
| 25 μL | |
| DNA Polymerases, DNA Repair | |
| 56655 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu