missing translation for 'onlineSavingsMsg'
Learn More
Learn More
POLE4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
415.00€ - 624.00€
Spécification
| Antigène | POLE4 |
|---|---|
| Dilution | Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugué | Unconjugated |
| Code produit | Marque | Quantité | Prix | Quantité et disponibilité | |||||
|---|---|---|---|---|---|---|---|---|---|
| Code produit | Marque | Quantité | Prix | Quantité et disponibilité | |||||
|
18604619
|
Novus Biologicals
NBP2-49672-25ul |
25 μL |
415.00€
25µL |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | |||||
|
18679046
|
Novus Biologicals
NBP2-49672 |
0.1 mL |
624.00€
0.10mL |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | |||||
Description
POLE4 Polyclonal antibody specifically detects POLE4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Spécification
| POLE4 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| DNA Polymerases, DNA Repair | |
| PBS (pH 7.2), 40% Glycerol | |
| 56655 | |
| IgG | |
| Immunogen affinity purified |
| Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| DNA polymerase epsilon p12 subunit, DNA polymerase epsilon subunit 4, DNA polymerase epsilon subunit p12, DNA polymerase II subunit 4, EC 2.7.7.7, p12, polymerase (DNA-directed), epsilon 4 (p12 subunit), YHHQ1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: GQEAIFILARAAELFVETIAKDAYCCAQQGKRKTLQRRDLDNAIEAVDEFAFLEGTLD | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit