missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RBBP4/RbAp48 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marque: Novus Biologicals NBP2-56286-25ul
Les retours ne sont pas autorisés pour ce produit.
Afficher la politique du retour.
Description
RBBP4/RbAp48 Polyclonal specifically detects RBBP4/RbAp48 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Spécification
| RBBP4/RbAp48 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
| CAF-1 subunit C, CAF-I p48, Chromatin assembly factor 1 subunit C, Chromatin assembly factor I p48 subunit, chromatin assembly factor/CAF-1 p48 subunit, histone-binding protein RBBP4, MSI1 protein homolog, Nucleosome-remodeling factor subunit RBAP48, NURF55, RbAp48, RBBP-4, retinoblastoma binding protein 4, Retinoblastoma-binding protein 4°CAF-I 48 kDa subunit, Retinoblastoma-binding protein p48 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. | |
| IgG |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| RBBP4 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:IIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHT | |
| 25 μL | |
| Cancer, Cell Cycle and Replication, Chromatin Research, Growth and Development, Stem Cell Markers, Tumor Suppressors | |
| 5928 | |
| Human | |
| Purified |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
For Research Use Only
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu