missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RBBP4/RbAp48 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
369.00€ - 593.00€
Spécification
| Antigène | RBBP4/RbAp48 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugué | Unconjugated |
| Espèces hôtes | Rabbit |
| Código de producto | Marca | Quantité | Precio | Cantidad y disponibilidad | |||||
|---|---|---|---|---|---|---|---|---|---|
| Código de producto | Marca | Quantité | Precio | Cantidad y disponibilidad | |||||
|
18220684
|
Novus Biologicals
NBP2-56286 |
100 μL |
593.00€
100µL |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | |||||
|
18655606
|
Novus Biologicals
NBP2-56286-25ul |
25 μL |
369.00€
25µL |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | |||||
Descripción
RBBP4/RbAp48 Polyclonal specifically detects RBBP4/RbAp48 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Especificaciones
| RBBP4/RbAp48 | |
| Polyclonal | |
| Rabbit | |
| Cancer, Cell Cycle and Replication, Chromatin Research, Growth and Development, Stem Cell Markers, Tumor Suppressors | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| RBBP4 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 5928 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:IIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHT | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto