missing translation for 'onlineSavingsMsg'
Learn More

RWDD4A Antibody, Novus Biologicals™

Code produit. 18479550 Tous les produits Bio Techne Produits
Change view
Click to view available options
Quantité:
0.1 mL
25ul
Conditionnement:
0.10mL
25µL
Code produit. Quantité unitSize
18479550 25ul 25µL
18222528 0.1 mL 0.10mL
2 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 18479550

Marque: Novus Biologicals NBP18474325ul

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Rabbit Polyclonal Antibody

RWDD4A Polyclonal specifically detects RWDD4A in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Spécification

Antigène RWDD4A
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugué Unconjugated
Dilution Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Formule PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Alias de gène FAM28A, member A, MGC10198, Protein FAM28A, RWD domain containing 4, RWD domain containing 4A, RWD domain-containing protein 4, RWD domain-containing protein 4A, RWDD4A
Symboles de gène(s) RWDD4
Espèces hôtes Rabbit
Immunogène This antibody was developed against Recombinant Protein corresponding to amino acids:EALRSIYEGDESFRELSPVSFQYRIGENGDPKAFLIEISWTETYPQTPPILSMNAFFNNTISSAVKQSILAKLQEAVEANLGTAM
Méthode de purification Affinity Purified
Quantité 25ul
État réglementaire RUO
Primaire ou secondaire Primary
Identification génétique (Entrez) 201965
Spécificité du test Specificity of human RWDD4A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Espèces cibles Human, Mouse, Rat
Contenu et stockage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Afficher plus Afficher moins

For Research Use Only

Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.