missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Signal peptide peptidase-like 2B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marque: Novus Biologicals NBP2-55073-25ul
Les retours ne sont pas autorisés pour ce produit.
Afficher la politique du retour.
Description
Signal peptide peptidase-like 2B Polyclonal specifically detects Signal peptide peptidase-like 2B in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Spécification
| Signal peptide peptidase-like 2B | |
| Polyclonal | |
| Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL | |
| EC 3.4.23, EC 3.4.23.-, IMP-4, IMP4MGC111084, Intramembrane protease 4, KIAA1532signal peptide peptidase-like 2B, Presenilin-like protein 1, PSL1, SNPPL2B, SPPL2b, SPP-like 2B | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 56928 | |
| Human | |
| IgG |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| SPPL2B | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:YWAGSRDVKKRYMKHKRDDGPEKQEDEAVDV | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
For Research Use Only
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu