missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Signal peptide peptidase-like 2B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
280.00€ - 572.00€
Spécification
| Antigène | Signal peptide peptidase-like 2B |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugué | Unconjugated |
| Espèces hôtes | Rabbit |
| Code produit | Marque | Quantité | Prix | Quantité et disponibilité | |||||
|---|---|---|---|---|---|---|---|---|---|
| Code produit | Marque | Quantité | Prix | Quantité et disponibilité | |||||
|
18219031
|
Novus Biologicals
NBP2-55073 |
100 μL |
572.00€
100µL |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | |||||
|
18694717
|
Novus Biologicals
NBP2-55073-25ul |
25 μL |
280.00€
25µL |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | |||||
Description
Signal peptide peptidase-like 2B Polyclonal specifically detects Signal peptide peptidase-like 2B in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Spécification
| Signal peptide peptidase-like 2B | |
| Polyclonal | |
| Rabbit | |
| Human | |
| EC 3.4.23, EC 3.4.23.-, IMP-4, IMP4MGC111084, Intramembrane protease 4, KIAA1532signal peptide peptidase-like 2B, Presenilin-like protein 1, PSL1, SNPPL2B, SPPL2b, SPP-like 2B | |
| SPPL2B | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 56928 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:YWAGSRDVKKRYMKHKRDDGPEKQEDEAVDV | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit