missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC6A2/NET/Noradrenaline transporter Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
Marque: Novus Biologicals NBP3-33387-100ul
Les retours ne sont pas autorisés pour ce produit.
Afficher la politique du retour.
Description
SLC6A2/NET/Noradrenaline transporter Monoclonal antibody specifically detects SLC6A2/NET/Noradrenaline transporter in Human samples. It is validated for ELISA,Western Blot
Spécification
| SLC6A2/NET/Noradrenaline transporter | |
| Monoclonal | |
| Western Blot 1:2000 - 1:10000, ELISA Recommended starting concentration is 1 μg/mL | |
| NAT1neurotransmitter transporter, NET, NET1sodium-dependent noradrenaline transporter, Norepinephrine transporter, SLC6A5, solute carrier family 6 (neurotransmitter transporter, noradrenalin), member 2, Solute carrier family 6 member 2, solute carrier family 6 member 5 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human SLC6A2/NET/Noradrenaline transporter.1).,, Sequence:, MLLARMNPQVQPENNGADTGPEQPLRARKTAELLVVKERNGVQCLLAPRDGDAQPRETWGKKIDFLLSVV | |
| 100 μL | |
| Cardiovascular Biology, Neuroscience | |
| 6530 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu