missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SSPN Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Marque: Novus Biologicals NBP2-93891-0.02ml
Les retours ne sont pas autorisés pour ce produit.
Afficher la politique du retour.
Description
SSPN Polyclonal antibody specifically detects SSPN in Human, Mouse, Rat samples. It is validated for Western Blot
Spécification
| SSPN | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| DAGA5, Kirsten-ras associated, Kirsten-ras-associated protein, KRAGNSPN, K-ras oncogene-associated protein, microspan, nanospan, sarcospan, sarcospan (Kras oncogene-associated gene), SPN1, SPN2 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-60 of human SSPN (NP_005077.2). MGKNKQPRGQQRQGGPPAADAAGPDDMEPKKGTGAPKECGEEEPRTCCGCRFPLLLALLQ | |
| 0.02 mL | |
| Cell Biology, Cytoskeleton Markers, Signal Transduction | |
| 8082 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu