missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SSPN Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
201.00€ - 470.00€
Spécification
| Antigène | SSPN |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugué | Unconjugated |
| Code produit | Marque | Quantité | Prix | Quantité et disponibilité | |||||
|---|---|---|---|---|---|---|---|---|---|
| Code produit | Marque | Quantité | Prix | Quantité et disponibilité | |||||
|
18619650
|
Novus Biologicals
NBP2-93891-0.02ml |
0.02 mL |
201.00€
0.02mL |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | |||||
|
18631061
|
Novus Biologicals
NBP2-93891-0.1ml |
0.1 mL |
470.00€
0.10mL |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | |||||
Description
SSPN Polyclonal antibody specifically detects SSPN in Human, Mouse, Rat samples. It is validated for Western BlotSpécification
| SSPN | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cell Biology, Cytoskeleton Markers, Signal Transduction | |
| PBS (pH 7.3), 50% glycerol | |
| 8082 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| DAGA5, Kirsten-ras associated, Kirsten-ras-associated protein, KRAGNSPN, K-ras oncogene-associated protein, microspan, nanospan, sarcospan, sarcospan (Kras oncogene-associated gene), SPN1, SPN2 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-60 of human SSPN (NP_005077.2). MGKNKQPRGQQRQGGPPAADAAGPDDMEPKKGTGAPKECGEEEPRTCCGCRFPLLLALLQ | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit