missing translation for 'onlineSavingsMsg'
Learn More
Learn More
STIL Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Marque: Novus Biologicals NBP2-93458-0.02ml
Les retours ne sont pas autorisés pour ce produit.
Afficher la politique du retour.
Description
STIL Polyclonal antibody specifically detects STIL in Human samples. It is validated for Western Blot
Spécification
| STIL | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| MCPH7, SCL/TAL1 Interrupting Locus, SCL-Interrupting Locus Protein, SIL, TAL1 (SCL) Interrupting Locus, TAL-1-Interrupting Locus Protein | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1218-1287 of human STIL (NP_003026.2). LVKNLKPSPAVNLRTGKAEFTQHPEKENEGDITIFPESLQPSETLKQMNSMNSVGTFLDVKRLRQLPKLF | |
| 0.02 mL | |
| Cell Biology, Cell Cycle and Replication, Stem Cells | |
| 6491 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu