Sulfatase Modifying Factor 1/SUMF1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marque: Novus Biologicals NBP1-83905-25ul

Code nomenclature Nacres: NA.46

Afficher plus de versions de ce produit

Code produit. 18436900

433.00€ / 25µL

Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Sulfatase Modifying Factor 1/SUMF1 Polyclonal specifically detects Sulfatase Modifying Factor 1/SUMF1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Spécification

Antigène	Sulfatase Modifying Factor 1/SUMF1
Classification	Polyclonal
Dilution	Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Alias de gène	AAPA3037, EC 1.8.99.-, FGEC-alpha-formylglycine-generating enzyme 1, FGly-generating enzyme, MGC131853, MGC150436, sulfatase modifying factor 1, sulfatase-modifying factor 1, UNQ3037
Espèces hôtes	Rabbit
Méthode de purification	Affinity Purified
État réglementaire	RUO
Identification génétique (Entrez)	285362
Espèces cibles	Human, Mouse, Rat
Isotype	IgG

Applications	Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugué	Unconjugated
Formule	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Symboles de gène(s)	SUMF1
Immunogène	This antibody was developed against Recombinant Protein corresponding to amino acids:MDAYEVSNTEFEKFVNSTGYLTEAEKFGDSFVFEGMLSEQVKTNIQQAVAAAPWWLPVKGANWRHPEGPDSTILHR
Quantité	25 μL
Primaire ou secondaire	Primary
Spécificité du test	Specificity of human Sulfatase Modifying Factor 1/SUMF1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Contenu et stockage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Produktvorschläge

Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts

Ihr Name

E-Mail Adresse *

Art der Problems *

Detaillierte Beschreibung des Problems/der Anfrage *

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Abbrechen Absenden

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt

For Research Use Only

Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur

Sulfatase Modifying Factor 1/SUMF1 Antibody, Novus Biologicals™

Description

Spécification

Produktvorschläge

Dokumentation

Aktionen