missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Sulfatase Modifying Factor 1/SUMF1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
433.00€ - 572.00€
Spécification
| Antigène | Sulfatase Modifying Factor 1/SUMF1 |
|---|---|
| Dilution | Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugué | Unconjugated |
| Code produit | Marque | Quantité | Prix | Quantité et disponibilité | |||||
|---|---|---|---|---|---|---|---|---|---|
| Code produit | Marque | Quantité | Prix | Quantité et disponibilité | |||||
|
18436900
|
Novus Biologicals
NBP1-83905-25ul |
25 μL |
433.00€
25µL |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | |||||
|
18250896
|
Novus Biologicals
NBP1-83905 |
0.1 mL |
572.00€
0.10mL |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | |||||
Description
Sulfatase Modifying Factor 1/SUMF1 Polyclonal specifically detects Sulfatase Modifying Factor 1/SUMF1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Spécification
| Sulfatase Modifying Factor 1/SUMF1 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 285362 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:MDAYEVSNTEFEKFVNSTGYLTEAEKFGDSFVFEGMLSEQVKTNIQQAVAAAPWWLPVKGANWRHPEGPDSTILHR | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Human, Mouse, Rat | |
| AAPA3037, EC 1.8.99.-, FGEC-alpha-formylglycine-generating enzyme 1, FGly-generating enzyme, MGC131853, MGC150436, sulfatase modifying factor 1, sulfatase-modifying factor 1, UNQ3037 | |
| SUMF1 | |
| IgG | |
| Affinity Purified | |
| Specificity of human Sulfatase Modifying Factor 1/SUMF1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit