missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SUMO-interacting Motif (SIM) Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marque: Novus Biologicals NBP2-55180-25ul
Les retours ne sont pas autorisés pour ce produit.
Afficher la politique du retour.
Description
SUMO-interacting Motif (SIM) Polyclonal specifically detects SUMO-interacting Motif (SIM) in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Spécification
| SUMO-interacting Motif (SIM) | |
| Polyclonal | |
| Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Chromosome 5 Open Reading Frame 25, Oocyte Maturation Associated 1, OOMA1, Platform Element For Inhibition Of Autolytic Degradation, PLEIAD, SIMC1, SUMO-Interacting Motif-Containing Protein 1, SUMO-Interacting Motifs Containing 1 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| SIMC1 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:YVIDLTRAEGENRPIATLDLTLEPVTPSQREPTSLQTCASLSGKAVMEGQVDRSSQPTARRLINSDPVDLDLVEE | |
| 25 μL | |
| Cancer, DNA Repair, DNA replication Transcription Translation and Splicing, mTOR Pathway | |
| 375484 | |
| Human | |
| IgG |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
For Research Use Only
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu