missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SUMO-interacting Motif (SIM) Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
415.00€ - 572.00€
Spécification
| Antigène | SUMO-interacting Motif (SIM) |
|---|---|
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugué | Unconjugated |
| Espèces hôtes | Rabbit |
| Code produit | Marque | Quantité | Prix | Quantité et disponibilité | |||||
|---|---|---|---|---|---|---|---|---|---|
| Code produit | Marque | Quantité | Prix | Quantité et disponibilité | |||||
|
18279471
|
Novus Biologicals
NBP2-55180 |
100 μL |
572.00€
100µL |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | |||||
|
18647458
|
Novus Biologicals
NBP2-55180-25ul |
25 μL |
415.00€
25µL |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | |||||
Description
SUMO-interacting Motif (SIM) Polyclonal specifically detects SUMO-interacting Motif (SIM) in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Spécification
| SUMO-interacting Motif (SIM) | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Chromosome 5 Open Reading Frame 25, Oocyte Maturation Associated 1, OOMA1, Platform Element For Inhibition Of Autolytic Degradation, PLEIAD, SIMC1, SUMO-Interacting Motif-Containing Protein 1, SUMO-Interacting Motifs Containing 1 | |
| SIMC1 | |
| IgG | |
| Affinity Purified |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 375484 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:YVIDLTRAEGENRPIATLDLTLEPVTPSQREPTSLQTCASLSGKAVMEGQVDRSSQPTARRLINSDPVDLDLVEE | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit