missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TIPIN Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
Marque: Novus Biologicals NBP1-83650-25ul
Les retours ne sont pas autorisés pour ce produit.
Afficher la politique du retour.
Description
TIPIN Polyclonal specifically detects TIPIN in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Spécification
| TIPIN | |
| Polyclonal | |
| Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000 | |
| FLJ20516, TIMELESS interacting protein, TIMELESS-interacting protein | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| TIPIN | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:EEQQQRIERNKQLALERRQAKLLSNSQTLGNDMLMNTPRAHTVEEVNTDEDQKEESNGLNEDILDNPCNDAIA | |
| 25 μL | |
| DNA Repair | |
| 54962 | |
| Human | |
| IgG |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
For Research Use Only
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu