missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TIPIN Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
433.00€ - 624.00€
Spécification
| Antigène | TIPIN |
|---|---|
| Dilution | Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence |
| Classification | Polyclonal |
| Conjugué | Unconjugated |
| Product Code | Brand | Quantité | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantité | Price | Quantity & Availability | |||||
|
18427930
|
Novus Biologicals
NBP1-83650-25ul |
25 μL |
433.00€
25µL |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | |||||
|
18291226
|
Novus Biologicals
NBP1-83650 |
0.1 mL |
624.00€
0.10mL |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | |||||
Description
TIPIN Polyclonal specifically detects TIPIN in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| TIPIN | |
| Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| FLJ20516, TIMELESS interacting protein, TIMELESS-interacting protein | |
| TIPIN | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000 | |
| Polyclonal | |
| Rabbit | |
| DNA Repair | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 54962 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:EEQQQRIERNKQLALERRQAKLLSNSQTLGNDMLMNTPRAHTVEEVNTDEDQKEESNGLNEDILDNPCNDAIA | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title