missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TMEM108 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marque: Novus Biologicals NBP2-38991-25ul
Les retours ne sont pas autorisés pour ce produit.
Afficher la politique du retour.
Description
TMEM108 Polyclonal specifically detects TMEM108 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Spécification
| TMEM108 | |
| Polyclonal | |
| Western Blot 1:250 - 1:500, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Q6UXF1 | |
| TMEM108 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: EPEPSTLTPRTPLWGYSSSPQPQTVAATTVPSNTSWAPTTTSLGPAKDKPGLRRAAQGGGSTFTSQGGTPDATAASGAPVSPQAAPVP | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| cancer/testis antigen 124, CT124, KIAA1690, MGC3040, transmembrane protein 108 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 66000 | |
| Human | |
| IgG |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu