missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TMEM108 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
280.00€ - 624.00€
Spécification
| Antigène | TMEM108 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugué | Unconjugated |
| Espèces hôtes | Rabbit |
| Code produit | Marque | Quantité | Prix | Quantité et disponibilité | |||||
|---|---|---|---|---|---|---|---|---|---|
| Code produit | Marque | Quantité | Prix | Quantité et disponibilité | |||||
|
18649035
|
Novus Biologicals
NBP2-38991-25ul |
25 μL |
280.00€
25µL |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | |||||
|
18142328
|
Novus Biologicals
NBP2-38991 |
0.1 mL |
624.00€
0.10mL |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | |||||
Description
TMEM108 Polyclonal specifically detects TMEM108 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Spécification
| TMEM108 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q6UXF1 | |
| 66000 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: EPEPSTLTPRTPLWGYSSSPQPQTVAATTVPSNTSWAPTTTSLGPAKDKPGLRRAAQGGGSTFTSQGGTPDATAASGAPVSPQAAPVP | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| cancer/testis antigen 124, CT124, KIAA1690, MGC3040, transmembrane protein 108 | |
| TMEM108 | |
| IgG | |
| Affinity Purified |
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit