missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TRACP/PAP/ACP5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marque: Novus Biologicals NBP2-38874
Les retours ne sont pas autorisés pour ce produit.
Afficher la politique du retour.
Description
TRACP/PAP/ACP5 Polyclonal specifically detects TRACP/PAP/ACP5 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Spécification
| TRACP/PAP/ACP5 | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| P13686 | |
| ACP5 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: THCLVKQLRPLLATYGVTAYLCGHDHNLQYLQDENGVGYVLSGAGNFMDPSKRHQRKVPNGYLRFHYGTEDSLG | |
| 0.1 mL | |
| Protein Phosphatase | |
| 54 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| HPAP, TRACP5a, TRACP5b, TRAP, TrATPase | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu