missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TSG101 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Marque: Novus Biologicals NBP2-94900-0.02ml
Les retours ne sont pas autorisés pour ce produit.
Afficher la politique du retour.
Description
TSG101 Polyclonal antibody specifically detects TSG101 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
Spécification
| TSG101 | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000, Immunocytochemistry/ Immunofluorescence 1:50-1:200 | |
| ESCRT-I complex subunit TSG101, TSG10, tumor susceptibility gene 10, tumor susceptibility gene 101, tumor susceptibility gene 101 protein, tumor susceptibility protein, VPS23 | |
| A synthetic peptide corresponding to a sequence within amino acids 291-390 of human TSG101 (NP_006283.1). LKKKDEELSSALEKMENQSENNDIDEVIIPTAPLYKQILNLYAEENAIEDTIFYLGEALRRGVIDLDVFLKHVRLLSRKQFQLRALMQKARKTAGLSDLY | |
| 0.02 mL | |
| Autophagy, Cancer, Microautophagy | |
| 7251 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu