missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TSG101 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
190.00€ - 470.00€
Spécification
| Antigène | TSG101 |
|---|---|
| Dilution | Western Blot 1:500 - 1:1000, Immunocytochemistry/ Immunofluorescence 1:50-1:200 |
| Applications | Western Blot, Immunofluorescence |
| Classification | Polyclonal |
| Conjugué | Unconjugated |
| Code produit | Marque | Quantité | Prix | Quantité et disponibilité | |||||
|---|---|---|---|---|---|---|---|---|---|
| Code produit | Marque | Quantité | Prix | Quantité et disponibilité | |||||
|
18644872
|
Novus Biologicals
NBP2-94900-0.02ml |
0.02 mL |
190.00€
0.02mL |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | |||||
|
18660902
|
Novus Biologicals
NBP2-94900-0.1ml |
0.1 mL |
470.00€
0.10mL |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | |||||
Description
TSG101 Polyclonal antibody specifically detects TSG101 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ ImmunofluorescenceSpécification
| TSG101 | |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Autophagy, Cancer, Microautophagy | |
| PBS (pH 7.3), 50% glycerol | |
| 7251 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:1000, Immunocytochemistry/ Immunofluorescence 1:50-1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| ESCRT-I complex subunit TSG101, TSG10, tumor susceptibility gene 10, tumor susceptibility gene 101, tumor susceptibility gene 101 protein, tumor susceptibility protein, VPS23 | |
| A synthetic peptide corresponding to a sequence within amino acids 291-390 of human TSG101 (NP_006283.1). LKKKDEELSSALEKMENQSENNDIDEVIIPTAPLYKQILNLYAEENAIEDTIFYLGEALRRGVIDLDVFLKHVRLLSRKQFQLRALMQKARKTAGLSDLY | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit