missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TSG101 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94900-0.02ml
This item is not returnable.
View return policy
Description
TSG101 Polyclonal antibody specifically detects TSG101 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
Specifications
| TSG101 | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000, Immunocytochemistry/ Immunofluorescence 1:50-1:200 | |
| ESCRT-I complex subunit TSG101, TSG10, tumor susceptibility gene 10, tumor susceptibility gene 101, tumor susceptibility gene 101 protein, tumor susceptibility protein, VPS23 | |
| A synthetic peptide corresponding to a sequence within amino acids 291-390 of human TSG101 (NP_006283.1). LKKKDEELSSALEKMENQSENNDIDEVIIPTAPLYKQILNLYAEENAIEDTIFYLGEALRRGVIDLDVFLKHVRLLSRKQFQLRALMQKARKTAGLSDLY | |
| 0.02 mL | |
| Autophagy, Cancer, Microautophagy | |
| 7251 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction