Two pore calcium channel protein 2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Marque: Novus Biologicals NBP1-86923

Code nomenclature Nacres: NA.46

Afficher plus de versions de ce produit

Code produit. 18055434

554.00€ / 0.10mL

Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Two pore calcium channel protein 2 Polyclonal specifically detects Two pore calcium channel protein 2 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Spécification

Antigène	Two pore calcium channel protein 2
Classification	Polyclonal
Dilution	Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Alias de gène	FLJ41094, SHEP10, TPC2two pore calcium channel protein 2, two pore segment channel 2, two-pore calcium channel protein 2, Voltage-dependent calcium channel protein TPC2
Espèces hôtes	Rabbit
Méthode de purification	Affinity Purified
État réglementaire	RUO
Identification génétique (Entrez)	219931
Espèces cibles	Human
Isotype	IgG

Applications	Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugué	Unconjugated
Formule	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Symboles de gène(s)	TPCN2
Immunogène	This antibody was developed against Recombinant Protein corresponding to amino acids:QFRGYLMKSLQTSLFRRRLGTRAAFEVLSSMVGEGGAFPQAVGVKPQNLLQVLQKVQLDSSHRQAMMEKVRSYGSVLLSAEEFQKLFNELDRSVVKEHPPRPEYQSPFLQSAQFLFGHYYF
Quantité	0.1 mL
Primaire ou secondaire	Primary
Spécificité du test	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Contenu et stockage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Suggestions de produits

Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

Votre nom

Votre adresse e-mail *

Type de problème *

Description détaillée du problème/de la demande *

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Annuler Soumettre

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis

For Research Use Only

Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu

Two pore calcium channel protein 2 Antibody, Novus Biologicals™

Description

Spécification

Suggestions de produits

Documents

Promotions