missing translation for 'onlineSavingsMsg'
Learn More
Learn More
WDSOF1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marque: Novus Biologicals NBP2-47580-25ul
Les retours ne sont pas autorisés pour ce produit.
Afficher la politique du retour.
Description
WDSOF1 Polyclonal specifically detects WDSOF1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Spécification
| WDSOF1 | |
| Polyclonal | |
| Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| DDB1 and CUL4 associated factor 13, DKFZp564O0463, GM83, HSPC064, MGC126859, MGC138247, WD repeat and SOF domain-containing protein 1, WD repeats and SOF1 domain containing, WDSOF1 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 25879 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| DCAF13 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: GIGTRFCGTSFFTVGDDKTVKQWKMDGPGYGDEEEPLHTILGKTVYTGIDHHWKEAVFATCGQQVDIWDEQRTNPICSMTWGFD | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
For Research Use Only
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu